PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57215.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 286aa    MW: 30311 Da    PI: 9.9469
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57215.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM36.61.3e-1143894128
           NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  MLOC_57215.2   4 AESSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 38 
                   557789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.947159IPR003441NAC domain
SuperFamilySSF1019416.28E-14658IPR003441NAC domain
PfamPF023653.3E-41038IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MIRAESSRPI GLKKTLVFYS GKAPKGVRSS WIMNEYRLPT ADTDRYHKTE ISLCRVYKRT  60
GIDDGRGHPS SARSTMPSRR GAEARQDNRQ GSSSTSTPTP PPTPSKLHLL QAGECTSPPA  120
PITTDHAQAH RPAAAPRQQV AETVKPSGGS LGFLQSAAAA DRHQQEGAAA LLYQQYSKST  180
NTFASTYSLL NLVNAASMGV ASAAAIDELS TLVGHGAAQL PSYHSPASTG GHHNHFVVPL  240
PTPPSQPITP LGTLPMSLAA ISDKIWDWNP IPDAVAGRDY GGAGFK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197620.0FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695832.17e-92PREDICTED: NAC transcription factor ONAC010
TrEMBLM0X5K10.0M0X5K1_HORVD; Uncharacterized protein
STRINGMLOC_57215.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.24e-32NAC domain containing protein 35